- Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1147893
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,105 Da
- E Coli or Yeast
- 1-116
- Putative transmembrane protein ORF116 (ORF116)
Sequence
MEYVEPLAPLYGGEYSTTGIVTLSVGIALLVLANAFAYALVKAFGIQSYYGRLLGGIVLLVLSMLLTLSTNSINKFRGAFTFAIGEIIIGGLDVINDKSGWSQPVVSPTVGCQGGA